Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli Histone H2B protein

This E.coli Histone H2B protein spans the amino acid sequence from region 2-93aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Histone H2B

UniProt

P14001

Expression Region

2-93aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Cairina moschata (Muscovy duck)

Field of Research

Infectious Disease & Virology; Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PEPAKSAPAPKKGSKKAVTKTQKKGDKKRKKSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

c-Fos (phospho Ser32) Polyclonal Antibody
MBS9242194-01 0.1 mL

c-Fos (phospho Ser32) Polyclonal Antibody

Sign In for Pricing
View Details
c-Fos (phospho Ser32) Polyclonal Antibody
MBS9242194-02 5x 0.1 mL

c-Fos (phospho Ser32) Polyclonal Antibody

Sign In for Pricing
View Details
ALKBH5 Protein Vector (Human) (pPB-His-GST)
PV321335 500 ng

ALKBH5 Protein Vector (Human) (pPB-His-GST)

Sign In for Pricing
View Details
ALKB3 Polyclonal Antibody
RA31269-01 50 µL

ALKB3 Polyclonal Antibody

Sign In for Pricing
View Details
ALKB3 Polyclonal Antibody
RA31269-02 100 µL

ALKB3 Polyclonal Antibody

Sign In for Pricing
View Details
ONO-8130
C5743-5 5 mg

ONO-8130

Sign In for Pricing
View Details