Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli P30996 protein

This E.coli P30996 protein spans the amino acid sequence from region 1-436aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

P30996

UniProt

P30996

Expression Region

1-436aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Clostridium botulinum

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

53.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPVAINSFNYNDPVNDDTILYMQIPYEEKSKKYYKAFEIMRNVWIIPERNTIGTNPSDFDPPASLKNGSSAYYDPNYLTTDAEKDRYLKTTIKLFKRINSNPAGKVLLQEISYAKPYLGNDHTPIDEFSPVTRTTSVNIKLSTNVESSMLLNLLVLGAGPDIFESCCYPVRKLIDPDVVYDPSNYGFGSINIVTFSPEYEYTFNDISGGHNSSTESFIADPAISLAHELIHALHGLYGARGVTYEETIEVKQAPLMIAEKPIRLEEFLTFGGQDLNIITSAMKEKIYNNLLANYEKIATRLSEVNSAPPEYDINEYKDYFQWKYGLDKNADGSYTVNENKFNEIYKKLYSFTESDLANKFKVKCRNTYFIKYEFLKVPNLLDDDIYTVSEGFNIGNLAVNNRGQSIKLNPKIIDSIPDKGLVEKIVKFCKSVIPRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Connexin 33, Rat (CX33, Gap Junction Alpha 7 Protein, CXA-7) Control Peptide
C7854-27B 100 µg

Connexin 33, Rat (CX33, Gap Junction Alpha 7 Protein, CXA-7) Control Peptide

Sign In for Pricing
View Details
LLC-MK2 W96/60
86-9660 each

LLC-MK2 W96/60

Sign In for Pricing
View Details
CHI3L1 Rabbit Polyclonal Antibody (Cy5)
orb915305 100 µL

CHI3L1 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
MIB2 Polyclonal Antibody
RA33313-01 50 µL

MIB2 Polyclonal Antibody

Sign In for Pricing
View Details
MIB2 Polyclonal Antibody
RA33313-02 100 µL

MIB2 Polyclonal Antibody

Sign In for Pricing
View Details
Porcine Asialoglycoprotein Receptor 1 ASGR1 ELISA Kit
BG-POR10181 1 Each

Porcine Asialoglycoprotein Receptor 1 ASGR1 ELISA Kit

Sign In for Pricing
View Details