Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli P30996 protein

This E.coli P30996 protein spans the amino acid sequence from region 1-436aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

P30996

UniProt

P30996

Expression Region

1-436aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Clostridium botulinum

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

53.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPVAINSFNYNDPVNDDTILYMQIPYEEKSKKYYKAFEIMRNVWIIPERNTIGTNPSDFDPPASLKNGSSAYYDPNYLTTDAEKDRYLKTTIKLFKRINSNPAGKVLLQEISYAKPYLGNDHTPIDEFSPVTRTTSVNIKLSTNVESSMLLNLLVLGAGPDIFESCCYPVRKLIDPDVVYDPSNYGFGSINIVTFSPEYEYTFNDISGGHNSSTESFIADPAISLAHELIHALHGLYGARGVTYEETIEVKQAPLMIAEKPIRLEEFLTFGGQDLNIITSAMKEKIYNNLLANYEKIATRLSEVNSAPPEYDINEYKDYFQWKYGLDKNADGSYTVNENKFNEIYKKLYSFTESDLANKFKVKCRNTYFIKYEFLKVPNLLDDDIYTVSEGFNIGNLAVNNRGQSIKLNPKIIDSIPDKGLVEKIVKFCKSVIPRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Granzyme H Antibody
MBS9602121-01 0.1 mL

Granzyme H Antibody

Sign In for Pricing
View Details
Granzyme H Antibody
MBS9602121-02 0.2 mL

Granzyme H Antibody

Sign In for Pricing
View Details
Granzyme H Antibody
MBS9602121-03 5x 0.2 mL

Granzyme H Antibody

Sign In for Pricing
View Details
BtuC Antibody
orb810879 2 mg

BtuC Antibody

Sign In for Pricing
View Details
IGSF8 Antibody
orb678933 100 µL

IGSF8 Antibody

Sign In for Pricing
View Details
GIMAP8 Rabbit Polyclonal Antibody
orb513089 100 µg

GIMAP8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details