Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli P30996 protein

This E.coli P30996 protein spans the amino acid sequence from region 1-436aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

P30996

UniProt

P30996

Expression Region

1-436aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Clostridium botulinum

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

53.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPVAINSFNYNDPVNDDTILYMQIPYEEKSKKYYKAFEIMRNVWIIPERNTIGTNPSDFDPPASLKNGSSAYYDPNYLTTDAEKDRYLKTTIKLFKRINSNPAGKVLLQEISYAKPYLGNDHTPIDEFSPVTRTTSVNIKLSTNVESSMLLNLLVLGAGPDIFESCCYPVRKLIDPDVVYDPSNYGFGSINIVTFSPEYEYTFNDISGGHNSSTESFIADPAISLAHELIHALHGLYGARGVTYEETIEVKQAPLMIAEKPIRLEEFLTFGGQDLNIITSAMKEKIYNNLLANYEKIATRLSEVNSAPPEYDINEYKDYFQWKYGLDKNADGSYTVNENKFNEIYKKLYSFTESDLANKFKVKCRNTYFIKYEFLKVPNLLDDDIYTVSEGFNIGNLAVNNRGQSIKLNPKIIDSIPDKGLVEKIVKFCKSVIPRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Zinc Finger Protein 726 (ZNF726) ELISA Kit
OM623385 96 Strip Well

Bovine Zinc Finger Protein 726 (ZNF726) ELISA Kit

Sign In for Pricing
View Details
Anti-PRSS8 Antibody Picoband®, Carrier-free
A05561-2-carrier-free 100 µg/Vial

Anti-PRSS8 Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
Anti-Sm-D3/SNRPD3 Antibody Picoband® Fluoro550 Conjugated
A09533-1-Fluoro550 100 µg/Vial

Anti-Sm-D3/SNRPD3 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
Human Dengue Fever IgG Antibody (DF-Ab-IgG) ELISA Kit
MBS2801383-01 48 Tests

Human Dengue Fever IgG Antibody (DF-Ab-IgG) ELISA Kit

Sign In for Pricing
View Details
Human Dengue Fever IgG Antibody (DF-Ab-IgG) ELISA Kit
MBS2801383-02 96 Tests

Human Dengue Fever IgG Antibody (DF-Ab-IgG) ELISA Kit

Sign In for Pricing
View Details
Human Dengue Fever IgG Antibody (DF-Ab-IgG) ELISA Kit
MBS2801383-03 5x 96 Tests

Human Dengue Fever IgG Antibody (DF-Ab-IgG) ELISA Kit

Sign In for Pricing
View Details