Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli cwlM protein

This E.coli cwlM protein spans the amino acid sequence from region 1-253aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CwlM

UniProt

P37134

Expression Region

1-253aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Bacillus licheniformis

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVKIFIDPGHGGSDTGASANGLQEKQLTLQTALALRNMLLNEYQNVSVLLSRTSDQTVSLTQRTNAANSWGADYFLSIHMNAGGGTGFEDYIYPGVGAPTTTYRDIMHEEILKVVDFRDRGKKTANFHVLRETAMPALLTENGFVDNTNDAEKLKSSAFIQSIARGHANGLARAFNLSKNAAALYKVQIAAFRTKANADSLAAQAEAKGFDALVIYRDSLYKVQIGAFSSKENAEALVQQAKNAEFDTFIYQE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM185B (NR_000034) Human Tagged Lenti ORF Clone
RC219480L3 10 µg

TMEM185B (NR_000034) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Anti-SUMO4 antibody
STJ29653 100 µl

Anti-SUMO4 antibody

Sign In for Pricing
View Details
YMEL1, NT (YME1L1, FTSH1, YME1L, ATP-dependent zinc metalloprotease YME1L1, ATP-dependent metalloprotease FtsH1, Meg-4, Presenilin-associated metalloprotease, YME1-like protein 1) (Biotin) discontinued
043961-Biotin 200 µL

YMEL1, NT (YME1L1, FTSH1, YME1L, ATP-dependent zinc metalloprotease YME1L1, ATP-dependent metalloprotease FtsH1, Meg-4, Presenilin-associated metalloprotease, YME1-like protein 1) (Biotin) discontinued

Sign In for Pricing
View Details
ANKS6 (NM_173551) Human Over-expression Lysate
E45H15248-2 20 µg

ANKS6 (NM_173551) Human Over-expression Lysate

Sign In for Pricing
View Details
Rnf219 (NM_026047) Mouse Tagged ORF Clone
MR209723 10 µg

Rnf219 (NM_026047) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Chemokine C-X-C-Motif Receptor 7 (CXCR7) Magnetic Luminex Assay Kit
LKU604117 96 Tests

Chemokine C-X-C-Motif Receptor 7 (CXCR7) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details