Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Mug1 protein

This Mouse Mug1 protein spans the amino acid sequence from region 700-910aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mug1

UniProt

P28665

Expression Region

700-910aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of His-tag and expression region is 700-910aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TPEISWSLRTTLSKRPEEPPRKDPSSNDPLTETIRKYFPETWVWDIVTVNSTGLAEVEMTVPDTITEWKAGALCLSNDTGLGLSSVVPLQAFKPFFVEVSLPYSVVRGEAFMLKATVMNYLPTSMQMSVQLEASPDFTAVPVGDDQDSYCLSANGRHTSSWLVTPKSLGNVNFSVSAEAQQSSEPCGSEVATVPETGRKDTVVKVLIVEPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Lyrm1 ELISA Kit
ELI-12734r 96 Tests

Rat Lyrm1 ELISA Kit

Sign In for Pricing
View Details
Ninjurin 1 (NINJ1) Human Gene Knockout Kit (CRISPR)
KN408335 1 Kit

Ninjurin 1 (NINJ1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
6-Amino-2-methylthio-4 (3H) pyrimidinone
A1379-08 250 mg

6-Amino-2-methylthio-4 (3H) pyrimidinone

Sign In for Pricing
View Details
Rabbit Polyclonal Syntaxin 4 Antibody [HRP]
NBP2-32227H 0.1 mL

Rabbit Polyclonal Syntaxin 4 Antibody [HRP]

Sign In for Pricing
View Details
Rat Monoclonal Caspase-11 Antibody (8A5) [mFluor Violet 450 SE]
NBP2-80099MFV450 0.1 mL

Rat Monoclonal Caspase-11 Antibody (8A5) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
NMDAR1 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-23343R-BF680 100 µL

NMDAR1 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details