Rat Reg3b protein
This Rat Reg3b protein spans the amino acid sequence from region 27-175aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Reg3b
UniProt
P25031
Expression Region
27-175aa
Tag
N-terminal 6xHis-tagged
Source
E.coli
Origin
Rattus norvegicus (Rat)
Field of Research
Epigenetics, Immunology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
20.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full length of His-tag and expression region is 27-175aa
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
EDSPKKIPSARISCPKGSQAYGSYCYALFQIPQTWFDAELACQKRPEGHLVSVLNVAEASFLASMVKNTGNSYQYTWIGLHDPTLGGEPNGGGWEWSNNDIMNYVNWERNPSTALDRGFCGSLSRSSGFLRWRDTTCEVKLPYVCKFTG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
813223029999-01 1 Each
SCILOGEX SCI550-Pro LCD Digital 7 x 7 Magnetic Hotplate Stirrer, ceramic-glass plate, 220-240V, 50/60Hz Euro Plug
Sign In for Pricing
View Details 
MBS1600075-01 48 Well
Rat Potassium channel subfamily K member 15, KCNK15 ELISA Kit
Sign In for Pricing
View Details MBS1600075-02 96 Well
Rat Potassium channel subfamily K member 15, KCNK15 ELISA Kit
Sign In for Pricing
View Details MBS1600075-03 5x 96 Well
Rat Potassium channel subfamily K member 15, KCNK15 ELISA Kit
Sign In for Pricing
View Details MBS1600075-04 10x 96 Well
Rat Potassium channel subfamily K member 15, KCNK15 ELISA Kit
Sign In for Pricing
View Details 