Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli Prothoracicotropic hormone protein

This E.coli Prothoracicotropic hormone protein spans the amino acid sequence from region 116-224aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Prothoracicotropic hormone, (PTTH) [Cleaved into, P2K, P6K, Prothoracicotropic hormone]

UniProt

P17219

Expression Region

116-224aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Bombyx mori (Silk moth)

Field of Research

Infectious Disease & Virology; Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 116-224aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GNIQVENQAIPDPPCTCKYKKEIEDLGENSVPRFIETRNCNKTQQPTCRPPYICKESLYSITILKRRETKSQESLEIPNELKYRWVAESHPVSVACLCTRDYQLRYNNN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COCH Protein Vector (Human) (pPM-C-HA)
16536021 500 ng

COCH Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
ABCA1 (BC034824) Human Untagged Clone
SC104214 10 µg

ABCA1 (BC034824) Human Untagged Clone

Sign In for Pricing
View Details
Lentiviral mouse Rgs13 shRNA (UAS) - Lentiviral mouse Rgs13 shRNA (UAS, RFP) (100)
GTR15265200 1 Vial

Lentiviral mouse Rgs13 shRNA (UAS) - Lentiviral mouse Rgs13 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
MRS4719-d3
HY-151547S 1 Each

MRS4719-d3

Sign In for Pricing
View Details
ANKRD53 Protein Vector (Human) (pPM-C-HA)
12011021 500 ng

ANKRD53 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Nrf2 (Phospho-Ser40) Rabbit mAb
13360 50 µL

Nrf2 (Phospho-Ser40) Rabbit mAb

Sign In for Pricing
View Details