Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli AC1 protein

This E.coli AC1 protein spans the amino acid sequence from region 1-358aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AC1, AL1

UniProt

P14982

Expression Region

1-358aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

African cassava mosaic virus (isolate West Kenyan 844) (ACMV) (Cassava latent virus (isolate West Kenyan 844) )

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

56.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-358aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MRTPRFRIQAKNVFLTYPKCSIPKEHLLSFIQTLSLQSNPKFIKICRELHQNGEPHLHALIQFEGKITITNNRLFDCVHPSCSTSFHPNIQGAKSSSDVKSYLDKDGDTVEWGQFQIDGRSARGGQQSANDAYAKALNSGSKSEALNVIRELVPKDFVLQFHNLNSNLDRIFQEPPAPYVSPFPCSSFDQVPVEIEEWVADNVRDSAARPWRPNSIVIEGDSRTGKTIWARSLGPHNYLCGHLDLSPKVFNNAAWYNVIDDVDPHYLKHFKEFMGSQRDWQSNTKYGKPVQIKGGIPTIFLCNPGPTSSYKEFLAEEKQEALKAWALKNAIFITLTEPLYSGSNQSHSQTSQEASHPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HECW1-IT1 Protein Vector (Human) (pPB-N-His)
PV082670 500 ng

HECW1-IT1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
1700081L11Rik Protein Vector (Mouse) (pPB-C-His)
PV147358 500 ng

1700081L11Rik Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Uev1A Rabbit Polyclonal Antibody
orb2988014-01 30 µL

Uev1A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Uev1A Rabbit Polyclonal Antibody
orb2988014-02 50 µL

Uev1A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Uev1A Rabbit Polyclonal Antibody
orb2988014-03 100 µL

Uev1A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Uev1A Rabbit Polyclonal Antibody
orb2988014-04 200 µL

Uev1A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details