Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli vpx protein

This E.coli vpx protein spans the amino acid sequence from region 1-112aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Vpx

UniProt

P19508

Expression Region

1-112aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Simian immunodeficiency virus (isolate PBj14/BCL-3) (SIV-sm) (Simian immunodeficiency virus sooty mangabey monkey)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-112aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSDPRERIPPGNSGEETIGEAFDWLDRTVEEINRAAVNHLPRELIFQVWRRSWEYWHDEMGMSVSYTKYRYLCLIQKAMFMHCKKGCRCLGGEHGAGGWRPGPPPPPPPGLA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP70-2 Antibody / HSPA1B
V5117-20UG 20 µg

HSP70-2 Antibody / HSPA1B

Sign In for Pricing
View Details
Anti-Aromatase/CYP19A1 Antibody Picoband®, Cy3 Conjugate
A00071-Cy3 100 µg/Vial

Anti-Aromatase/CYP19A1 Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details
NR1D1 Rabbit Polyclonal Antibody (Cy5)
orb958408 100 µL

NR1D1 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
Recombinant Human Early growth response protein 1, His, Yeast-50ug
QP9116-ye-50ug 50ug

Recombinant Human Early growth response protein 1, His, Yeast-50ug

Sign In for Pricing
View Details
SensiFAST Probe No-ROX Kit
BIO-86005 500 rxns

SensiFAST Probe No-ROX Kit

Sign In for Pricing
View Details
SOCS5 Antibody
OACA09201-100UL 100 µL

SOCS5 Antibody

Sign In for Pricing
View Details