Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli vpx protein

This E.coli vpx protein spans the amino acid sequence from region 1-112aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Vpx

UniProt

P19508

Expression Region

1-112aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Simian immunodeficiency virus (isolate PBj14/BCL-3) (SIV-sm) (Simian immunodeficiency virus sooty mangabey monkey)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-112aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSDPRERIPPGNSGEETIGEAFDWLDRTVEEINRAAVNHLPRELIFQVWRRSWEYWHDEMGMSVSYTKYRYLCLIQKAMFMHCKKGCRCLGGEHGAGGWRPGPPPPPPPGLA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-MYL3 Antibody
MBS8208474-01 0.03 mL

Anti-MYL3 Antibody

Sign In for Pricing
View Details
Anti-MYL3 Antibody
MBS8208474-02 0.05 mL

Anti-MYL3 Antibody

Sign In for Pricing
View Details
Anti-MYL3 Antibody
MBS8208474-03 0.1 mL

Anti-MYL3 Antibody

Sign In for Pricing
View Details
Anti-MYL3 Antibody
MBS8208474-04 0.2 mL

Anti-MYL3 Antibody

Sign In for Pricing
View Details
Anti-MYL3 Antibody
MBS8208474-05 5x 0.2 mL

Anti-MYL3 Antibody

Sign In for Pricing
View Details
Genorise® human MMP-3 Polyclonal Antibody
GR126176 100 µg

Genorise® human MMP-3 Polyclonal Antibody

Sign In for Pricing
View Details