Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HLA-E protein

This Human HLA-E protein spans the amino acid sequence from region 22-305aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HLA-E

UniProt

P13747

Expression Region

22-305aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of Alpha-1 and Alpha-2 and Alpha-3 of His-SUMO-tag and expression region is 22-305aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDRRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRWKPASQPTIPI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

α, ω-Bis-Pyridyldithio PEG
116000-44.5G 5 g

α, ω-Bis-Pyridyldithio PEG

Sign In for Pricing
View Details
Recombinant Human B7-H4/VTCN1 Protein (Fc Tag)
PKSH033755-01 10 µg

Recombinant Human B7-H4/VTCN1 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human B7-H4/VTCN1 Protein (Fc Tag)
PKSH033755-02 50 µg

Recombinant Human B7-H4/VTCN1 Protein (Fc Tag)

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF594 conjugate, 0.1mg/mL
BNC940178-500 1x 500 µL

CD50 (ICAM-3) (186-2G9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Blood Group Antigen B (CD173) (HEB-20), CF568 conjugate, 0.1mg/mL
BNC680296-100 1x 100 µL

Blood Group Antigen B (CD173) (HEB-20), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Lung Specific Antigen (LSA120), CF647 conjugate, 0.1mg/mL
BNC470120-100 1x 100 µL

Lung Specific Antigen (LSA120), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details