Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HLA-E protein

This Human HLA-E protein spans the amino acid sequence from region 22-305aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HLA-E

UniProt

P13747

Expression Region

22-305aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of Alpha-1 and Alpha-2 and Alpha-3 of His-SUMO-tag and expression region is 22-305aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDRRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRWKPASQPTIPI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Prostate
CR560098 5 µg

Tissue Total RNA, Prostate

Sign In for Pricing
View Details
IRF1 (Center) Rabbit Polyclonal Antibody
AP52233PU-N 400 µL

IRF1 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse LTA4H Protein (His Tag)
PKSM040768 50 µg

Recombinant Mouse LTA4H Protein (His Tag)

Sign In for Pricing
View Details
3-Hydroxyphthalic Anhydride
TRC-H951270-5G 5 g

3-Hydroxyphthalic Anhydride

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD11a Antibody[FD441.8]
E-AB-F1033UM-01 25 µg

Elab Fluor® 647 Anti-Mouse CD11a Antibody[FD441.8]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD11a Antibody[FD441.8]
E-AB-F1033UM-02 100 µg

Elab Fluor® 647 Anti-Mouse CD11a Antibody[FD441.8]

Sign In for Pricing
View Details