Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli LMP1 protein

This E.coli LMP1 protein spans the amino acid sequence from region 185-386aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LMP1

UniProt

P13198

Expression Region

185-386aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Epstein-Barr virus (strain Raji) (HHV-4) (Human herpesvirus 4)

Field of Research

Infectious Disease & Virology; Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of Cytoplasmic of His-SUMO-tag and expression region is 185-386aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YYHGQRHSDEHHHDDSLPHPQQATDDSSNQSDSNSNEGRHLLLVSGAGDGPPLCSQNLGAPGGGPNNGPQDPDNTDDNGPQDPDNTDDNGPHDPLPQDPDNTDDNGPQDPDNTDDNGPHDPLPHNPSDSAGNDGGPPQLTEEVENKGGDQGPPLMTDGGGGHSHDSGHDGIDPHLPTLLLGTSGSGGDDDDPHGPVQLSYYD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Fibroblast growth factor 22 ELISA Kit
orb1659697 96 Tests

Mouse Fibroblast growth factor 22 ELISA Kit

Sign In for Pricing
View Details
Recombinant Human SNW1 Protein
E30P03139A 50 µg

Recombinant Human SNW1 Protein

Sign In for Pricing
View Details
AMELY siRNA (Human)
CRH0181-01 15 nmol

AMELY siRNA (Human)

Sign In for Pricing
View Details
AMELY siRNA (Human)
CRH0181-02 30 nmol

AMELY siRNA (Human)

Sign In for Pricing
View Details
SUMO2 Antibody
A40765-50UG 50 µg

SUMO2 Antibody

Sign In for Pricing
View Details
Diphtheria toxin
MBS324189-01 1 mL

Diphtheria toxin

Sign In for Pricing
View Details