What is the catalog number for E.coli Gellan lyase protein?

The catalog number for E.coli Gellan lyase protein is orb246478.

What sizes are available for E.coli Gellan lyase protein?

E.coli Gellan lyase protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does E.coli Gellan lyase protein come in?

E.coli Gellan lyase protein is available in 3 different pack sizes.

Is E.coli Gellan lyase protein in stock?

E.coli Gellan lyase protein is currently made to order / not held in immediate stock. Contact us for lead time.

E.coli Gellan lyase protein

This E.coli Gellan lyase protein spans the amino acid sequence from region 1-204aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Gellan lyase, EC 4.2.2.25, Fragments

UniProt

P85513

Expression Region

1-204aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Geobacillus stearothermophilus (Bacillus stearothermophilus)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 1-204aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LVSESNPGRAIPAGGKGATIRAARPGLATTLNGPKAGNGTTGATKLTTPARPLSEGANMMCDHRAGGNAAISGSSVGEGTARAGDSKVMSRMLSPKGSIIAGTVNMMPADIAAGSVRTPSSLPPDGRSATPMSVSEVASDISHKDGSVNVTKDPVTAAGLTAMRKNANKGSPPASPLPLKADNKGVHINKHWVDLKNDNDFNTR