Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli Gellan lyase protein

This E.coli Gellan lyase protein spans the amino acid sequence from region 1-204aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Gellan lyase, EC 4.2.2.25, Fragments

UniProt

P85513

Expression Region

1-204aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Geobacillus stearothermophilus (Bacillus stearothermophilus)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 1-204aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LVSESNPGRAIPAGGKGATIRAARPGLATTLNGPKAGNGTTGATKLTTPARPLSEGANMMCDHRAGGNAAISGSSVGEGTARAGDSKVMSRMLSPKGSIIAGTVNMMPADIAAGSVRTPSSLPPDGRSATPMSVSEVASDISHKDGSVNVTKDPVTAAGLTAMRKNANKGSPPASPLPLKADNKGVHINKHWVDLKNDNDFNTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ST13 Polyclonal Antibody
HA672014-01 50 µg

Anti-ST13 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-ST13 Polyclonal Antibody
HA672014-02 100 µg

Anti-ST13 Polyclonal Antibody

Sign In for Pricing
View Details
Aldh3a1 (NM_007436) Mouse Tagged ORF Clone Lentiviral Particle
MR216262L4V 200 µL

Aldh3a1 (NM_007436) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human Vascuolar cell adhesion molecule 1,VCAM-1 ELISA kit
CN-03271H1 96T

Human Vascuolar cell adhesion molecule 1,VCAM-1 ELISA kit

Sign In for Pricing
View Details
Cleaved-ITI-H2 (D702) Polyclonal Antibody
ABP50067-01 30 µL

Cleaved-ITI-H2 (D702) Polyclonal Antibody

Sign In for Pricing
View Details
Cleaved-ITI-H2 (D702) Polyclonal Antibody
ABP50067-02 100 µL

Cleaved-ITI-H2 (D702) Polyclonal Antibody

Sign In for Pricing
View Details