Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli zipA protein

This E. coli zipA protein spans the amino acid sequence from region 1-328aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ZipA

UniProt

P77173

Expression Region

1-328aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-328aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MMQDLRLILIIVGAIAIIALLVHGFWTSRKERSSMFRDRPLKRMKSKRDDDSYDEDVEDDEGVGEVRVHRVNHAPANAQEHEAARPSPQHQYQPPYASAQPRQPVQQPPEAQVPPQHAPHPAQPVQQPAYQPQPEQPLQQPVSPQVAPAPQPVHSAPQPAQQAFQPAEPVAAPQPEPVAEPAPVMDKPKRKEAVIIMNVAAHHGSELNGELLLNSIQQAGFIFGDMNIYHRHLSPDGSGPALFSLANMVKPGTFDPEMKDFTTPGVTIFMQVPSYGDELQNFKLMLQSAQHIADEVGGVVLDDQRRMMTPQKLREYQDIIREVKDANA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SHARPIN polyclonal antibody
BS71652-01 50 µL

SHARPIN polyclonal antibody

Sign In for Pricing
View Details
SHARPIN polyclonal antibody
BS71652-02 100 µL

SHARPIN polyclonal antibody

Sign In for Pricing
View Details
MEK1 antibody
70R-36980 0.1 mg

MEK1 antibody

Sign In for Pricing
View Details
Rabbit BAP18 Antibody
orb1523426-01 10 µL

Rabbit BAP18 Antibody

Sign In for Pricing
View Details
Rabbit BAP18 Antibody
orb1523426-02 100 µL

Rabbit BAP18 Antibody

Sign In for Pricing
View Details
Recombinant Escherichia coli UDP-2,3-diacylglucosamine hydrolase (lpxH)
MBS1215278-01 0.02 mg (E-Coli)

Recombinant Escherichia coli UDP-2,3-diacylglucosamine hydrolase (lpxH)

Sign In for Pricing
View Details