Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli zipA protein

This E. coli zipA protein spans the amino acid sequence from region 1-328aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ZipA

UniProt

P77173

Expression Region

1-328aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-328aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MMQDLRLILIIVGAIAIIALLVHGFWTSRKERSSMFRDRPLKRMKSKRDDDSYDEDVEDDEGVGEVRVHRVNHAPANAQEHEAARPSPQHQYQPPYASAQPRQPVQQPPEAQVPPQHAPHPAQPVQQPAYQPQPEQPLQQPVSPQVAPAPQPVHSAPQPAQQAFQPAEPVAAPQPEPVAEPAPVMDKPKRKEAVIIMNVAAHHGSELNGELLLNSIQQAGFIFGDMNIYHRHLSPDGSGPALFSLANMVKPGTFDPEMKDFTTPGVTIFMQVPSYGDELQNFKLMLQSAQHIADEVGGVVLDDQRRMMTPQKLREYQDIIREVKDANA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD35 Monoclonal Antibody
MBS2579924-01 0.1 mL

CD35 Monoclonal Antibody

Sign In for Pricing
View Details
CD35 Monoclonal Antibody
MBS2579924-02 0.2 mL

CD35 Monoclonal Antibody

Sign In for Pricing
View Details
CD35 Monoclonal Antibody
MBS2579924-03 1 mL

CD35 Monoclonal Antibody

Sign In for Pricing
View Details
CD35 Monoclonal Antibody
MBS2579924-04 5x 1 mL

CD35 Monoclonal Antibody

Sign In for Pricing
View Details
Hsa-miR-4700-3p miRNA Mimic
orb1877223-01 5 nmol

Hsa-miR-4700-3p miRNA Mimic

Sign In for Pricing
View Details
Hsa-miR-4700-3p miRNA Mimic
orb1877223-02 10 nmol

Hsa-miR-4700-3p miRNA Mimic

Sign In for Pricing
View Details