Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli alaC protein

This E. coli alaC protein spans the amino acid sequence from region 1-412aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AlaC

UniProt

P77434

Expression Region

1-412aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

62.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-412aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MADTRPERRFTRIDRLPPYVFNITAELKMAARRRGEDIIDFSMGNPDGATPPHIVEKLCTVAQRPDTHGYSTSRGIPRLRRAISRWYQDRYDVEIDPESEAIVTIGSKEGLAHLMLATLDHGDTVLVPNPSYPIHIYGAVIAGAQVRSVPLVEGVDFFNELERAIRESYPKPKMMILGFPSNPTAQCVELEFFEKVVALAKRYDVLVVHDLAYADIVYDGWKAPSIMQVPGARDVAVEFFTLSKSYNMAGWRIGFMVGNKTLVSALARIKSYHDYGTFTPLQVAAIAALEGDQQCVRDIAEQYKRRRDVLVKGLHEAGWMVEMPKASMYVWAKIPEPYAAMGSLEFAKKLLNEAKVCVSPGIGFGDYGDTHVRFALIENRDRIRQAIRGIKAMFRADGLLPASSKHIHENAE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CIAPIN1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
16163061 1.0 µg DNA

CIAPIN1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
GENLISA™ Human secretogranin-1 chromogranin-B (CHGB / SCG1) ELISA
KBH6130 96 Well

GENLISA™ Human secretogranin-1 chromogranin-B (CHGB / SCG1) ELISA

Sign In for Pricing
View Details
CYP24 (E-7) Alexa Fluor® 680
sc-365700 AF680 200 µg/mL

CYP24 (E-7) Alexa Fluor® 680

Sign In for Pricing
View Details
Recombinant Helicobacter Pylori hslU Protein (aa 1-443)
VAng-Lsx3494-1mgEcoli 1 mg (E. coli)

Recombinant Helicobacter Pylori hslU Protein (aa 1-443)

Sign In for Pricing
View Details
Rat HTR7 shRNA Plasmid
abx986365-01 150 µg

Rat HTR7 shRNA Plasmid

Sign In for Pricing
View Details
Rat HTR7 shRNA Plasmid
abx986365-02 300 µg

Rat HTR7 shRNA Plasmid

Sign In for Pricing
View Details