Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli alaC protein

This E. coli alaC protein spans the amino acid sequence from region 1-412aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AlaC

UniProt

P77434

Expression Region

1-412aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

62.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-412aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MADTRPERRFTRIDRLPPYVFNITAELKMAARRRGEDIIDFSMGNPDGATPPHIVEKLCTVAQRPDTHGYSTSRGIPRLRRAISRWYQDRYDVEIDPESEAIVTIGSKEGLAHLMLATLDHGDTVLVPNPSYPIHIYGAVIAGAQVRSVPLVEGVDFFNELERAIRESYPKPKMMILGFPSNPTAQCVELEFFEKVVALAKRYDVLVVHDLAYADIVYDGWKAPSIMQVPGARDVAVEFFTLSKSYNMAGWRIGFMVGNKTLVSALARIKSYHDYGTFTPLQVAAIAALEGDQQCVRDIAEQYKRRRDVLVKGLHEAGWMVEMPKASMYVWAKIPEPYAAMGSLEFAKKLLNEAKVCVSPGIGFGDYGDTHVRFALIENRDRIRQAIRGIKAMFRADGLLPASSKHIHENAE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

P2rx1 (NM_001142367) Rat Tagged ORF Clone Lentiviral Particle
RR200412L4V 200 µL

P2rx1 (NM_001142367) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
VPS13D Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-12766R-BF488 100 µL

VPS13D Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
FCGRT (NM_001136019) Human Mass Spec Standard
PH327329 10 µg

FCGRT (NM_001136019) Human Mass Spec Standard

Sign In for Pricing
View Details
Kctd4 3'UTR Lenti-reporter-Luc Vector
25454084 1.0 µg

Kctd4 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
LIPA siRNA (Human)
CRH2700-01 15 nmol

LIPA siRNA (Human)

Sign In for Pricing
View Details
LIPA siRNA (Human)
CRH2700-02 30 nmol

LIPA siRNA (Human)

Sign In for Pricing
View Details