Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human UBD protein

This Human UBD protein spans the amino acid sequence from region 1-165aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

UBD

UniProt

O15205

Expression Region

1-165aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-165aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAPNASCLCVHVRSEEWDLMTFDANPYDSVKKIKEHVRSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKPSDEELPLFLVESGDEAKRHLLQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGIRKGNLLFLACYCIGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIP60 Mouse Monoclonal Antibody
AMM80598-01 1 Each

TIP60 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
TIP60 Mouse Monoclonal Antibody
AMM80598-02 50 µL

TIP60 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
TIP60 Mouse Monoclonal Antibody
AMM80598-03 100 µL

TIP60 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
HECTD2 antibody
38691 100 µL

HECTD2 antibody

Sign In for Pricing
View Details
Lentiviral human SRMS shRNA (UAS) - Lentiviral human SRMS shRNA (UAS) plasmid
GTR15313918 1 Vial

Lentiviral human SRMS shRNA (UAS) - Lentiviral human SRMS shRNA (UAS) plasmid

Sign In for Pricing
View Details
RGS9BP Antibody - N-terminal region : HRP (ARP65375_P050-HRP)
ARP65375_P050-HRP 100 µL

RGS9BP Antibody - N-terminal region : HRP (ARP65375_P050-HRP)

Sign In for Pricing
View Details