Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human UBD protein

This Human UBD protein spans the amino acid sequence from region 1-165aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

UBD

UniProt

O15205

Expression Region

1-165aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-165aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAPNASCLCVHVRSEEWDLMTFDANPYDSVKKIKEHVRSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKPSDEELPLFLVESGDEAKRHLLQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGIRKGNLLFLACYCIGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-A (HLA Class I Histocompatibility Antigen, FLJ26655, HLAA) (HRP)
MBS6420890-01 0.1 mL

HLA-A (HLA Class I Histocompatibility Antigen, FLJ26655, HLAA) (HRP)

Sign In for Pricing
View Details
HLA-A (HLA Class I Histocompatibility Antigen, FLJ26655, HLAA) (HRP)
MBS6420890-02 5x 0.1 mL

HLA-A (HLA Class I Histocompatibility Antigen, FLJ26655, HLAA) (HRP)

Sign In for Pricing
View Details
Alpha-inosine
HY-154535 1 Each

Alpha-inosine

Sign In for Pricing
View Details
Lab Jack 100x100mm Blue
JAC1000 1 Each

Lab Jack 100x100mm Blue

Sign In for Pricing
View Details
Parp2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6602408 1.0 µg DNA

Parp2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Human Uncoupling Protein 2, Mitochondrial (UCP2) ELISA Kit
MBS9307932-01 48 Well

Human Uncoupling Protein 2, Mitochondrial (UCP2) ELISA Kit

Sign In for Pricing
View Details