Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TPST2 protein

This Human TPST2 protein spans the amino acid sequence from region 26-377aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TPST2

UniProt

O60704

Expression Region

26-377aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

55.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Expression region is 26-377aa and His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QQVLECRAVLAGLRSPRGAMRPEQEELVMVGTNHVEYRYGKAMPLIFVGGVPRSGTTLMRAMLDAHPEVRCGEETRIIPRVLAMRQAWSKSGREKLRLDEAGVTDEVLDAAMQAFILEVIAKHGEPARVLCNKDPFTLKSSVYLSRLFPNSKFLLMVRDGRASVHSMITRKVTIAGFDLSSYRDCLTKWNKAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVLHHEDLIGKPGGVSLSKIERSTDQVIKPVNLEALSKWTGHIPGDVVRDMAQIAPMLAQLGYDPYANPPNYGNPDPFVINNTQRVLKGDYKTPANLKGYFQVNQNSTSSHLGSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alpha-protein Kinase 2 Polyclonal Antibody
RA21819-01 50 µL

Alpha-protein Kinase 2 Polyclonal Antibody

Sign In for Pricing
View Details
Alpha-protein Kinase 2 Polyclonal Antibody
RA21819-02 100 µL

Alpha-protein Kinase 2 Polyclonal Antibody

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Alpha-2-Glycoprotein 1, Zinc Binding (aZGP1)
MBS2082707-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Alpha-2-Glycoprotein 1, Zinc Binding (aZGP1)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Alpha-2-Glycoprotein 1, Zinc Binding (aZGP1)
MBS2082707-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Alpha-2-Glycoprotein 1, Zinc Binding (aZGP1)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Alpha-2-Glycoprotein 1, Zinc Binding (aZGP1)
MBS2082707-03 0.5 mL

Cy3-Linked Polyclonal Antibody to Alpha-2-Glycoprotein 1, Zinc Binding (aZGP1)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Alpha-2-Glycoprotein 1, Zinc Binding (aZGP1)
MBS2082707-04 1 mL

Cy3-Linked Polyclonal Antibody to Alpha-2-Glycoprotein 1, Zinc Binding (aZGP1)

Sign In for Pricing
View Details