Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TPD52 protein

This Human TPD52 protein spans the amino acid sequence from region 1-184aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TPD52

UniProt

P55327

Expression Region

1-184aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of Isoform 2 of His-SUMO-tag and expression region is 1-184aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDRGEQGLLRTDPVPEEGEDVAATISATETLSEEEQEELRRELAKVEEEIQTLSQVLAAKEKHLAEIKRKLGINSLQELKQNIAKGWQDVTATSAYKKTSETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-VWA1 Antibody
A11504 100 µL

Anti-VWA1 Antibody

Sign In for Pricing
View Details
Human SEC24C qPCR Primer Pair
QH29129S 200 Tests

Human SEC24C qPCR Primer Pair

Sign In for Pricing
View Details
hsa-miR-374a-3p miRNA Antagomir
MNH02065 2x 5.0 nmol

hsa-miR-374a-3p miRNA Antagomir

Sign In for Pricing
View Details
Anti-SLC34A2 Antibody Picoband® Fluoro488 Conjugated
A03957-1-Fluoro488 100 µg/Vial

Anti-SLC34A2 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
Dotinurad Nitroso Impurity 103
RM-D152203-01 10 mg

Dotinurad Nitroso Impurity 103

Sign In for Pricing
View Details
Dotinurad Nitroso Impurity 103
RM-D152203-02 25 mg

Dotinurad Nitroso Impurity 103

Sign In for Pricing
View Details