Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TMEM141 protein

This Human TMEM141 protein spans the amino acid sequence from region 1-108aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TMEM141

UniProt

Q96I45

Expression Region

1-108aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of GST-tag and expression region is 1-108aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVNLGLSRVDDAVAAKHPGLGEYAACQSHAFMKGVFTFVTGTGMAFGLQMFIQRKFPYPLQWSLLVAVVAGSVVSYGVTRVESEKCNNLWLFLETGQLPKDRSTDQRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAT3 Monoclonal Antibody (1E3)
orb380437-01 50 μL

STAT3 Monoclonal Antibody (1E3)

Sign In for Pricing
View Details
STAT3 Monoclonal Antibody (1E3)
orb380437-02 100 µL

STAT3 Monoclonal Antibody (1E3)

Sign In for Pricing
View Details
N⁶- (4- Aminobutyl) adenosine- 5'- O- triphosphate (6-AB-ATP), sodium salt
A 074-05 5 µmol ~ 2.9 mg

N⁶- (4- Aminobutyl) adenosine- 5'- O- triphosphate (6-AB-ATP), sodium salt

Sign In for Pricing
View Details
Anti-NUPL2/NUP42 Antibody Picoband®, Dylight550 Conjugate
A09480-Dylight550 100 µg

Anti-NUPL2/NUP42 Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
Phospho-COX IV (Ser58) Blocking Peptide
MBS9616074-01 1 mg

Phospho-COX IV (Ser58) Blocking Peptide

Sign In for Pricing
View Details
Phospho-COX IV (Ser58) Blocking Peptide
MBS9616074-02 5x 1 mg

Phospho-COX IV (Ser58) Blocking Peptide

Sign In for Pricing
View Details