Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TMEM141 protein

This Human TMEM141 protein spans the amino acid sequence from region 1-108aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TMEM141

UniProt

Q96I45

Expression Region

1-108aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of GST-tag and expression region is 1-108aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVNLGLSRVDDAVAAKHPGLGEYAACQSHAFMKGVFTFVTGTGMAFGLQMFIQRKFPYPLQWSLLVAVVAGSVVSYGVTRVESEKCNNLWLFLETGQLPKDRSTDQRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COL4A3 Antibody
orb253404 100 µL

COL4A3 Antibody

Sign In for Pricing
View Details
Rat Sphingosine 1-phosphate receptor 5, S1PR5 ELISA Kit
MBS9338361-01 48 Well

Rat Sphingosine 1-phosphate receptor 5, S1PR5 ELISA Kit

Sign In for Pricing
View Details
Rat Sphingosine 1-phosphate receptor 5, S1PR5 ELISA Kit
MBS9338361-02 96 Well

Rat Sphingosine 1-phosphate receptor 5, S1PR5 ELISA Kit

Sign In for Pricing
View Details
Rat Sphingosine 1-phosphate receptor 5, S1PR5 ELISA Kit
MBS9338361-03 5x 96 Well

Rat Sphingosine 1-phosphate receptor 5, S1PR5 ELISA Kit

Sign In for Pricing
View Details
Rat Sphingosine 1-phosphate receptor 5, S1PR5 ELISA Kit
MBS9338361-04 10x 96 Well

Rat Sphingosine 1-phosphate receptor 5, S1PR5 ELISA Kit

Sign In for Pricing
View Details
Dehydroaripiprazole, Hydrochloride
D1959 2.5 mg

Dehydroaripiprazole, Hydrochloride

Sign In for Pricing
View Details