Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dog TJP1 protein

This Dog TJP1 protein spans the amino acid sequence from region 1633-1769aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TJP1

UniProt

O97758

Expression Region

1633-1769aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Canis lupus familiaris (Dog) (Canis familiaris)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of His-tag and expression region is 1633-1769aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VVATARGVFNNNGGVLSSIETGVSIIIPQGAIPEGVEQEIYFKVCRDNSILPPLDKEKGETLLSPLVMCGPHGLKFLKPVELRLPHCASMTPDGWSFALKSSDSSSGDPKTWQNKCLPGDPNYLVGANCVSVLIDHF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Myosin-XIX (MYO19) ELISA Kit
KTE61427-01 48 Tests

Human Myosin-XIX (MYO19) ELISA Kit

Sign In for Pricing
View Details
Human Myosin-XIX (MYO19) ELISA Kit
KTE61427-02 96 Tests

Human Myosin-XIX (MYO19) ELISA Kit

Sign In for Pricing
View Details
Human Myosin-XIX (MYO19) ELISA Kit
KTE61427-03 5x 96 Tests

Human Myosin-XIX (MYO19) ELISA Kit

Sign In for Pricing
View Details
Human Myosin-XIX (MYO19) ELISA Kit
KTE61427-04 50x 96 Tests

Human Myosin-XIX (MYO19) ELISA Kit

Sign In for Pricing
View Details
CD252 (TNFSF4) Human Recombinant Protein
TP723944 100 µg

CD252 (TNFSF4) Human Recombinant Protein

Sign In for Pricing
View Details
GDF7 (Growth Differentiation Factor 7, BMP12) (FITC)
246546-FITC 100 µL

GDF7 (Growth Differentiation Factor 7, BMP12) (FITC)

Sign In for Pricing
View Details