Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sheep TGFA protein

This Sheep TGFA protein spans the amino acid sequence from region 24-97aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TGFA

UniProt

P98135

Expression Region

24-97aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Ovis aries (Sheep)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of Extracellular of GST-tag and expression region is 24-97aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ENSTSALSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLLQEEKPACVCHSGYVGARCEHADLLAVVAASQKKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF695 Rabbit Polyclonal Antibody (BF750)
orb2418152 100 µL

ZNF695 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
CHST8 (NM_022467) Human Untagged Clone
SC319591 10 µg

CHST8 (NM_022467) Human Untagged Clone

Sign In for Pricing
View Details
GRAP2, ID (GRAP2, GADS, GRB2L, GRID, GRB2-related adapter protein 2, Adapter protein GRID, GRB-2-like protein, GRBLG, GRBX, Grf40 adapter protein, Growth factor receptor-binding protein, Hematopoietic cell-associated adapter protein GrpL, P38, Protein GADS, SH3-SH2-SH3 adapter Mona) (MaxLight 490) discontinued
036280-ML490 100 µL

GRAP2, ID (GRAP2, GADS, GRB2L, GRID, GRB2-related adapter protein 2, Adapter protein GRID, GRB-2-like protein, GRBLG, GRBX, Grf40 adapter protein, Growth factor receptor-binding protein, Hematopoietic cell-associated adapter protein GrpL, P38, Protein GADS, SH3-SH2-SH3 adapter Mona) (MaxLight 490) discontinued

Sign In for Pricing
View Details
BATF2 Protein Vector (Human) (pPB-C-His)
PV003529 500 ng

BATF2 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Mad1 Rabbit Polyclonal Antibody (Fluoro594)
orb3086857 200 µL

Mad1 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
Goat anti-Human IgG (H&L), Biotin conjugated, min, cross-reactivity to bovine, goat, mouse or rabbit serum proteins
AS16 3325 1 mg

Goat anti-Human IgG (H&L), Biotin conjugated, min, cross-reactivity to bovine, goat, mouse or rabbit serum proteins

Sign In for Pricing
View Details