Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sheep TGFA protein

This Sheep TGFA protein spans the amino acid sequence from region 24-97aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TGFA

UniProt

P98135

Expression Region

24-97aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Ovis aries (Sheep)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of Extracellular of GST-tag and expression region is 24-97aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ENSTSALSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLLQEEKPACVCHSGYVGARCEHADLLAVVAASQKKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nutf2-set siRNA/shRNA/RNAi Lentivector (Mouse)
32353094 4x 500 ng

Nutf2-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Rabbit Anti-GBDR1/UBAC1 Polyclonal Antibody
PAV7489 100 μL

Rabbit Anti-GBDR1/UBAC1 Polyclonal Antibody

Sign In for Pricing
View Details
TRITC Anti-cow/ human CD46 Antibody *MEM-258*
104601J0-AAT 100 Tests

TRITC Anti-cow/ human CD46 Antibody *MEM-258*

Sign In for Pricing
View Details
Anti-MMP28 Rabbit Polyclonal Antibody
orb2569280 100 µg

Anti-MMP28 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-XRCC1 Antibody Picoband® (monoclonal, 10E10)-iFluor647 Conjugate
M00571-2-iFluor647 100 µg

Anti-XRCC1 Antibody Picoband® (monoclonal, 10E10)-iFluor647 Conjugate

Sign In for Pricing
View Details
PPM1F Antibody
C49160-01 50 μL

PPM1F Antibody

Sign In for Pricing
View Details