Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TCEB1 protein

This Human TCEB1 protein spans the amino acid sequence from region 1-112aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TCEB1

UniProt

Q15369

Expression Region

1-112aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of GST-tag and expression region is 1-112aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dynorphin A (1-13), amide, porcine
E-PP-1059-01 10 mg

Dynorphin A (1-13), amide, porcine

Sign In for Pricing
View Details
Dynorphin A (1-13), amide, porcine
E-PP-1059-02 100 mg

Dynorphin A (1-13), amide, porcine

Sign In for Pricing
View Details
Dynorphin A (1-13), amide, porcine
E-PP-1059-03 5 mg

Dynorphin A (1-13), amide, porcine

Sign In for Pricing
View Details
RPS4Y1 Rabbit Polyclonal Antibody (BF680)
orb2476035 100 µL

RPS4Y1 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
Anti-PRC1 Antibody Picoband® (Cy3 Conjugate)
PB9814-Cy3 100 µg/Vial

Anti-PRC1 Antibody Picoband® (Cy3 Conjugate)

Sign In for Pricing
View Details
Canine Mucosal Addressin Cell Adhesion Molecule 1 ELISA Kit
MBS083666-01 48 Well

Canine Mucosal Addressin Cell Adhesion Molecule 1 ELISA Kit

Sign In for Pricing
View Details