Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli SPT15 protein

This E.coli SPT15 protein spans the amino acid sequence from region 2-240aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SPT15

UniProt

P13393

Expression Region

2-240aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 2-240aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAAPESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse C Reactive Protein ELISA Kit
MBS732342-01 48 Well

Mouse C Reactive Protein ELISA Kit

Sign In for Pricing
View Details
Mouse C Reactive Protein ELISA Kit
MBS732342-02 96 Well

Mouse C Reactive Protein ELISA Kit

Sign In for Pricing
View Details
Mouse C Reactive Protein ELISA Kit
MBS732342-03 5x 96 Well

Mouse C Reactive Protein ELISA Kit

Sign In for Pricing
View Details
Mouse C Reactive Protein ELISA Kit
MBS732342-04 10x 96 Well

Mouse C Reactive Protein ELISA Kit

Sign In for Pricing
View Details
PUMA Recombinant Rabbit Monoclonal Antibody [SR42-09]
ET1602-24 100 µL

PUMA Recombinant Rabbit Monoclonal Antibody [SR42-09]

Sign In for Pricing
View Details
CTSC Peptide - middle region
orb2011088 100 µg

CTSC Peptide - middle region

Sign In for Pricing
View Details