Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SLC27A2 protein

This Human SLC27A2 protein spans the amino acid sequence from region 283-620aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SLC27A2

UniProt

O14975

Expression Region

283-620aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

54.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Cytoplasmic domain of His-SUMO-tag and expression region is 283-620aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GATLALRTKFSASQFWDDCRKYNVTVIQYIGELLRYLCNSPQKPNDRDHKVRLALGNGLRGDVWRQFVKRFGDICIYEFYAATEGNIGFMNYARKVGAVGRVNYLQKKIITYDLIKYDVEKDEPVRDENGYCVRVPKGEVGLLVCKITQLTPFNGYAGAKAQTEKKKLRDVFKKGDLYFNSGDLLMVDHENFIYFHDRVGDTFRWKGENVATTEVADTVGLVDFVQEVNVYGVHVPDHEGRIGMASIKMKENHEFDGKKLFQHIADYLPSYARPRFLRIQDTIEITGTFKHRKMTLVEEGFNPAVIKDALYFLDDTAKMYVPMTEDIYNAISAKTLKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1199 3'UTR Luciferase Stable Cell Line
TU114709 1.0 mL

Olfr1199 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
GRB2 Knockout Cell Lysate
ABC-KC0789 100 µg

GRB2 Knockout Cell Lysate

Sign In for Pricing
View Details
Lentiviral mouse Vmn1r168 shRNA (UAS) - Lentiviral mouse Vmn1r168 shRNA (UAS, RFP) (25)
GTR15217607 1 Vial

Lentiviral mouse Vmn1r168 shRNA (UAS) - Lentiviral mouse Vmn1r168 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Human Glycosylated hemoglobin A1c ELISA Kit
E100660 1 Each

Human Glycosylated hemoglobin A1c ELISA Kit

Sign In for Pricing
View Details
Lentiviral human C2CD4A shRNA (UAS) - Lentiviral human C2CD4A shRNA (UAS) (100)
GTR15328017 1 Vial

Lentiviral human C2CD4A shRNA (UAS) - Lentiviral human C2CD4A shRNA (UAS) (100)

Sign In for Pricing
View Details
Recombinant Clostridium novyi Xanthine phosphoribosyltransferase (xpt)
MBS1131183-01 0.02 mg (E-Coli)

Recombinant Clostridium novyi Xanthine phosphoribosyltransferase (xpt)

Sign In for Pricing
View Details