Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SDF2 protein

This Human SDF2 protein spans the amino acid sequence from region 19-211aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SDF2

UniProt

Q99470

Expression Region

19-211aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 19-211aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SSLGVVTCGSVVKLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKSATVCERGTPIKCGQPIRLTHVNTGRNLHSHHFTSPLSGNQEVSAFGEEGEGDYLDDWTVLCNGPYWVRDGEVRFKHSSTEVLLSVTGEQYGRPISGQKEVHGMAQPSQNNYWKAMEGIFMKPSELLKAEAHHAEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Salmonella abony Repressor of phase 1 flagellin gene (fljA)
MBS1002011-01 0.02 mg (E-Coli)

Recombinant Salmonella abony Repressor of phase 1 flagellin gene (fljA)

Sign In for Pricing
View Details
Recombinant Salmonella abony Repressor of phase 1 flagellin gene (fljA)
MBS1002011-02 0.1 mg (E-Coli)

Recombinant Salmonella abony Repressor of phase 1 flagellin gene (fljA)

Sign In for Pricing
View Details
Recombinant Salmonella abony Repressor of phase 1 flagellin gene (fljA)
MBS1002011-03 0.02 mg (Yeast)

Recombinant Salmonella abony Repressor of phase 1 flagellin gene (fljA)

Sign In for Pricing
View Details
Recombinant Salmonella abony Repressor of phase 1 flagellin gene (fljA)
MBS1002011-04 0.1 mg (Yeast)

Recombinant Salmonella abony Repressor of phase 1 flagellin gene (fljA)

Sign In for Pricing
View Details
Recombinant Salmonella abony Repressor of phase 1 flagellin gene (fljA)
MBS1002011-05 0.02 mg (Baculovirus)

Recombinant Salmonella abony Repressor of phase 1 flagellin gene (fljA)

Sign In for Pricing
View Details
Recombinant Salmonella abony Repressor of phase 1 flagellin gene (fljA)
MBS1002011-06 0.02 mg (Mammalian-Cell)

Recombinant Salmonella abony Repressor of phase 1 flagellin gene (fljA)

Sign In for Pricing
View Details