Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse SAMHD1 protein

This Mouse SAMHD1 protein spans the amino acid sequence from region 395-626aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SAMHD1 MOP5 Mg11

UniProt

Q60710

Expression Region

395-626aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Expression region is 395-626aa and His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DIMITDAFLKADPYVEITGTAGKKFRISTAIDDMEAFTKLTDNIFLEVLHSTDPQLSEAQSILRNIECRNLYKYLGETQPKREKIRKEEYERLPQEVAKAKPEKAPDVELKAEDFIVDVINVDYGMEDKNPIDRVHFYCKSNSKQAVRINKEQVSQLLPEKFAEQLIRVYCKKKDGKSLDAAGKHFVQWCALRDFTKPQDGDIIAPLITPLKWNNKTSSCLQEVSKVKTCLK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

1- (2- ((3-brome-2,4-dimethylphenyl) thio) phenyl) piperazine hydrobromide
CS-O-35987 1 Each

1- (2- ((3-brome-2,4-dimethylphenyl) thio) phenyl) piperazine hydrobromide

Sign In for Pricing
View Details
Nup155 sgRNA CRISPR Lentivector (Rat) (Target 3)
K7124604 1.0 µg DNA

Nup155 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Mouse CAN2 ELISA Kit
E101670 1 Each

Mouse CAN2 ELISA Kit

Sign In for Pricing
View Details
TRAJ61 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV787590 1.0 µg DNA

TRAJ61 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Mouse Krt13 / Keratin, type I cytoskeletal 13 Recombinant Protein
R1875m 1 Each

Mouse Krt13 / Keratin, type I cytoskeletal 13 Recombinant Protein

Sign In for Pricing
View Details
Human 5-Hydroxytryptamine (5-HT) ELISA Kit
201-12-1316 96 Tests

Human 5-Hydroxytryptamine (5-HT) ELISA Kit

Sign In for Pricing
View Details