Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat S100A8 protein

This Rat S100A8 protein spans the amino acid sequence from region 2-89aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CAGA protein, Calgranulin-A protein, CFAG protein, CGLA protein, Chemotactic cytokine CP-10 protein, CP-10 protein, Cystic fibrosis antigen protein, L1Ag protein, Leukocyte L1 complex light chain protein, MA387 protein, Migration inhibitory factor-related protein 8 protein, Myeloid-related protein 8 protein, Neutrophil cytosolic 7 kDa protein protein, NIF protein, Pro-inflammatory S100 cytokine protein, Protein S100-A8 protein, S100 calcium binding protein A8 (calgranulin A) protein, S100 calcium binding protein A8 protein, S100A8 protein, S100A8/S100A9 complex, included protein, Urinary stone protein band A protein, MRP8 protein, MRP-8 protein, 60B8Ag protein

UniProt

P50115

Expression Region

2-89aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 2-89aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ATELEKALSNVIEVYHNYSGIKGNHHALYRDDFRKMVTTECPQFVQNKNTESLFKELDVNSDNAINFEEFLVLVIRVGVAAHKDSHKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NewPAGE Precast Protein Gel, Bis-Tris, 4-20%, 11 wells
PPG-002 10 Each

NewPAGE Precast Protein Gel, Bis-Tris, 4-20%, 11 wells

Sign In for Pricing
View Details
Endomorphin-2 Peptide
PE-55186-01 1 mg

Endomorphin-2 Peptide

Sign In for Pricing
View Details
Endomorphin-2 Peptide
PE-55186-02 5 mg

Endomorphin-2 Peptide

Sign In for Pricing
View Details
Endomorphin-2 Peptide
PE-55186-03 10 mg

Endomorphin-2 Peptide

Sign In for Pricing
View Details
Recombinant Human Fibronectin
MBS968146-01 0.2 mg

Recombinant Human Fibronectin

Sign In for Pricing
View Details
Recombinant Human Fibronectin
MBS968146-02 0.5 mg

Recombinant Human Fibronectin

Sign In for Pricing
View Details