Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RETN protein

This Human RETN protein spans the amino acid sequence from region 19-108aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RETN

UniProt

Q9HD89

Expression Region

19-108aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 19-108aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDK2 Antibody
F40239-0.4ML 0.4 mL

PDK2 Antibody

Sign In for Pricing
View Details
CD45RA (PTPRC/1148), CF405S conjugate, 0.1mg/mL
BNC041148-500 1x 500 µL

CD45RA (PTPRC/1148), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), 0.2mg/mL
BNUB0645-100 1x 100 µL

FOXP3 (3G3), 0.2mg/mL

Sign In for Pricing
View Details
Borrelia burgdorferi (p41 Flagellin) (6802), CF405S conjugate, 0.1mg/mL
BNC040144-100 1x 100 µL

Borrelia burgdorferi (p41 Flagellin) (6802), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CENPO Polyclonal Antibody
E-AB-11070-01 20 µL

CENPO Polyclonal Antibody

Sign In for Pricing
View Details
CENPO Polyclonal Antibody
E-AB-11070-02 60 µL

CENPO Polyclonal Antibody

Sign In for Pricing
View Details