Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RAB27B protein

This Human RAB27B protein spans the amino acid sequence from region 2-218aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RAB27B

UniProt

O00194

Expression Region

2-218aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 2-218aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD81 Antibody
KC-2845-01 50 μL

CD81 Antibody

Sign In for Pricing
View Details
CD81 Antibody
KC-2845-02 100 µL

CD81 Antibody

Sign In for Pricing
View Details
CD81 Antibody
KC-2845-03 1 mL

CD81 Antibody

Sign In for Pricing
View Details
Anti-EGFR Antibody Picoband® Fluoro647 Conjugated
A00023-4-Fluoro647 100 µg/Vial

Anti-EGFR Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Myelodysplasia Syndrome 1 Colorimetric Cell-Based ELISA Kit
MBS9500832-01 1 Kit

Myelodysplasia Syndrome 1 Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
Myelodysplasia Syndrome 1 Colorimetric Cell-Based ELISA Kit
MBS9500832-02 5x 1 Kit

Myelodysplasia Syndrome 1 Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details