Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PTPRB protein

This Human PTPRB protein spans the amino acid sequence from region 1643-1997aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PTPRB

UniProt

P23467

Expression Region

1643-1997aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

57.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of Cytoplasmic of His-SUMO-tag and expression region is 1643-1997aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RQKVSHGRERPSARLSIRRDRPLSVHLNLGQKGNRKTSCPIKINQFEGHFMKLQADSNYLLSKEYEELKDVGRNQSCDIALLPENRGKNRYNNILPYDATRVKLSNVDDDPCSDYINASYIPGNNFRREYIVTQGPLPGTKDDFWKMVWEQNVHNIVMVTQCVEKGRVKCDHYWPADQDSLYYGDLILQMLSESVLPEWTIREFKICGEEQLDAHRLIRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRSPGAGPTVVHCSAGVGRTGTFIALDRILQQLDSKDSVDIYGAVHDLRLHRVHMVQTECQYVYLHQCVRDVLRARKLRSEQENPLFPIYENVNPEYHRDPVYSRH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Thyroid gland
CS635253 5x 5 µm

Frozen Tissue Sections, Thyroid gland

Sign In for Pricing
View Details
GEMIN8 siRNA Oligos set (Human)
21442171 3x 5 nmol

GEMIN8 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Human Liver kinase B1,LKB1 ELISA KIT
JOT-EK6832Hu 96 wells

Human Liver kinase B1,LKB1 ELISA KIT

Sign In for Pricing
View Details
RAB3IL1 Adenovirus (Human)
38339051 1.0 mL

RAB3IL1 Adenovirus (Human)

Sign In for Pricing
View Details
Rat NPY2R (Neuropeptide Y Receptor Y2) Microsample ELISA Kit
ELK6578MS-01 48 Tests

Rat NPY2R (Neuropeptide Y Receptor Y2) Microsample ELISA Kit

Sign In for Pricing
View Details
Rat NPY2R (Neuropeptide Y Receptor Y2) Microsample ELISA Kit
ELK6578MS-02 96 Tests

Rat NPY2R (Neuropeptide Y Receptor Y2) Microsample ELISA Kit

Sign In for Pricing
View Details