Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PTPRB protein

This Human PTPRB protein spans the amino acid sequence from region 1643-1997aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PTPRB

UniProt

P23467

Expression Region

1643-1997aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

57.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of Cytoplasmic of His-SUMO-tag and expression region is 1643-1997aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RQKVSHGRERPSARLSIRRDRPLSVHLNLGQKGNRKTSCPIKINQFEGHFMKLQADSNYLLSKEYEELKDVGRNQSCDIALLPENRGKNRYNNILPYDATRVKLSNVDDDPCSDYINASYIPGNNFRREYIVTQGPLPGTKDDFWKMVWEQNVHNIVMVTQCVEKGRVKCDHYWPADQDSLYYGDLILQMLSESVLPEWTIREFKICGEEQLDAHRLIRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRSPGAGPTVVHCSAGVGRTGTFIALDRILQQLDSKDSVDIYGAVHDLRLHRVHMVQTECQYVYLHQCVRDVLRARKLRSEQENPLFPIYENVNPEYHRDPVYSRH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Alpha L Fucosidase, AFU GENLISA ELISA
KLS0107 96 Well

Sheep Alpha L Fucosidase, AFU GENLISA ELISA

Sign In for Pricing
View Details
ANGPT2, CT (ANGPT2, Angiopoietin-2)
031873 200 µL

ANGPT2, CT (ANGPT2, Angiopoietin-2)

Sign In for Pricing
View Details
IRAG1 (NM_001100167) Human Tagged ORF Clone
RG215802 10 µg

IRAG1 (NM_001100167) Human Tagged ORF Clone

Sign In for Pricing
View Details
ZO-1 Lentiviral Activation Particles (m2)
sc-423407-LAC-2 200 µL

ZO-1 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Human LRG1 ELISA Kit
LRG-20 96 Well

Human LRG1 ELISA Kit

Sign In for Pricing
View Details
Mouse Serine Palmitoyltransferase, Long Chain Base Subunit 2 (SPTLC2) ELISA Kit
DLR-SPTLC2-Mu-01 48 Tests

Mouse Serine Palmitoyltransferase, Long Chain Base Subunit 2 (SPTLC2) ELISA Kit

Sign In for Pricing
View Details