Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Prss1 protein

This Rat Prss1 protein spans the amino acid sequence from region 24-246aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Prss1

UniProt

P00762

Expression Region

24-246aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 24-246aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IVGGYTCPEHSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWIQDTIAAN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hydroxylammonium chloride
S5547-1g 1 g

Hydroxylammonium chloride

Sign In for Pricing
View Details
OTOGL rabbit pAb Antibody
orb2304400-01 50 µL

OTOGL rabbit pAb Antibody

Sign In for Pricing
View Details
OTOGL rabbit pAb Antibody
orb2304400-02 100 µL

OTOGL rabbit pAb Antibody

Sign In for Pricing
View Details
HSF2 (Heat Shock Factor Protein 2, HSF 2, Heat Shock Transcription Factor 2, HSTF 2, HSTF2, MGC117376, MGC156196, MGC75048) (MaxLight 405) discontinued
128109-ML405 100 µL

HSF2 (Heat Shock Factor Protein 2, HSF 2, Heat Shock Transcription Factor 2, HSTF 2, HSTF2, MGC117376, MGC156196, MGC75048) (MaxLight 405) discontinued

Sign In for Pricing
View Details
LRRC14 Protein Vector (Human) (pPM-C-His)
PV024280 500 ng

LRRC14 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
CR1L Rabbit Polyclonal Antibody (AP)
orb939695 100 µL

CR1L Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details