Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MTHFS protein

This Human MTHFS protein spans the amino acid sequence from region 2-203aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MTHFS

UniProt

P49914

Expression Region

2-203aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 2-203aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AAAAVSSAKRSLRGELKQRLRAMSAEERLRQSRVLSQKVIAHSEYQKSKRISIFLSMQDEIETEEIIKDIFQRGKICFIPRYRFQSNHMDMVRIESPEEISLLPKTSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQICLQVPVNENDMKVDEVLYEDSSTA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYBPC1 Rabbit Polyclonal Antibody (BF594)
orb2548283 100 µL

MYBPC1 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
Anti-BBS5 Antibody
75-321 100 µL

Anti-BBS5 Antibody

Sign In for Pricing
View Details
SARS-CoV-2 Spike RBD, Imdevimab Biosimilar
591920-01 100 µg

SARS-CoV-2 Spike RBD, Imdevimab Biosimilar

Sign In for Pricing
View Details
SARS-CoV-2 Spike RBD, Imdevimab Biosimilar
591920-02 1 mg

SARS-CoV-2 Spike RBD, Imdevimab Biosimilar

Sign In for Pricing
View Details
CCDC102B Antibody
orb685181 100 µL

CCDC102B Antibody

Sign In for Pricing
View Details
RHOH (Rho Related GTP Binding Protein RhoH, TTF, TTF Translocation Three Four, ARHH) (MaxLight 650)
MBS6449008-01 0.1 mL

RHOH (Rho Related GTP Binding Protein RhoH, TTF, TTF Translocation Three Four, ARHH) (MaxLight 650)

Sign In for Pricing
View Details