Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MRPL42 protein

This Human MRPL42 protein spans the amino acid sequence from region 33-142aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MRPL42

UniProt

Q9Y6G3

Expression Region

33-142aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of GST-tag and expression region is 33-142aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KSTYSPLPDDYNCNVELALTSDGRTIVCYHPSVDIPYEHTKPIPRPDPVHNNEETHDQVLKTRLEEKVEHLEEGPMIEQLSKMFFTTKHRWYPHGRYHRCRKNLNPPKDR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OACD02107-1ML - CA19-9 Antibody
OACD02107-1ML 1 mL

OACD02107-1ML - CA19-9 Antibody

Sign In for Pricing
View Details
Mouse Monoclonal CD5 Antibody (OTI7A7) [Alexa Fluor 750]
NBP2-70360AF750 0.1 mL

Mouse Monoclonal CD5 Antibody (OTI7A7) [Alexa Fluor 750]

Sign In for Pricing
View Details
Nitecapone-13C5
TRC-N490132-0.25MG 0.25 mg

Nitecapone-13C5

Sign In for Pricing
View Details
Guinea Pig Mitochondrial import receptor subunit TOM6 homolog (TOMM6) ELISA kit
GTR10398450 96 Well

Guinea Pig Mitochondrial import receptor subunit TOM6 homolog (TOMM6) ELISA kit

Sign In for Pricing
View Details
Nlrp4a Protein Vector (Rat) (pPM-C-HA)
31919026 500 ng

Nlrp4a Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Zscan5b ORF Vector (Mouse) (pORF)
ORF062788 1.0 µg DNA

Zscan5b ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details