Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MPV17 protein

This Human MPV17 protein spans the amino acid sequence from region 1-176aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MPV17

UniProt

P39210

Expression Region

1-176aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-176aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MALWRAYQRALAAHPWKVQVLTAGSLMGLGDIISQQLVERRGLQEHQRGRTLTMVSLGCGFVGPVVGGWYKVLDRFIPGTTKVDALKKMLLDQGGFAPCFLGCFLPLVGALNGLSAQDNWAKLQRDYPDALITNYYLWPAVQLANFYLVPLHYRLAVVQCVAVIWNSYLSWKAHRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C20ORF44 Protein Vector (Human) (pPB-N-His)
PV005998 500 ng

C20ORF44 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
ASAH2 Protein Vector (Rat) (pPB-C-His)
PV254814 500 ng

ASAH2 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Recombinant Human ATG2B Protein, N-His
orb2830445-01 20 µg

Recombinant Human ATG2B Protein, N-His

Sign In for Pricing
View Details
Recombinant Human ATG2B Protein, N-His
orb2830445-02 50 µg

Recombinant Human ATG2B Protein, N-His

Sign In for Pricing
View Details
Recombinant Human ATG2B Protein, N-His
orb2830445-03 100 µg

Recombinant Human ATG2B Protein, N-His

Sign In for Pricing
View Details
Thermal Stability Tester BPTL-209
BPTL-209 1 Unit

Thermal Stability Tester BPTL-209

Sign In for Pricing
View Details