Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MPV17 protein

This Human MPV17 protein spans the amino acid sequence from region 1-176aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MPV17

UniProt

P39210

Expression Region

1-176aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-176aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MALWRAYQRALAAHPWKVQVLTAGSLMGLGDIISQQLVERRGLQEHQRGRTLTMVSLGCGFVGPVVGGWYKVLDRFIPGTTKVDALKKMLLDQGGFAPCFLGCFLPLVGALNGLSAQDNWAKLQRDYPDALITNYYLWPAVQLANFYLVPLHYRLAVVQCVAVIWNSYLSWKAHRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF347 Protein Vector (Human) (pPB-N-His)
PV144923 500 ng

ZNF347 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
GPC6 Protein (N-His, Human)
P504303 100 µg

GPC6 Protein (N-His, Human)

Sign In for Pricing
View Details
Complement H (AHUS1, ARMD4, ARMS1, beta-1-H-Globulin, beta-1H, HF, HF1, HF2, HUS) (PE) discontinued
226890-PE 100 µL

Complement H (AHUS1, ARMD4, ARMS1, beta-1-H-Globulin, beta-1H, HF, HF1, HF2, HUS) (PE) discontinued

Sign In for Pricing
View Details
Acrylonitrile discontinued
258980-01 25 g

Acrylonitrile discontinued

Sign In for Pricing
View Details
Acrylonitrile discontinued
258980-02 50 g

Acrylonitrile discontinued

Sign In for Pricing
View Details
Acrylonitrile discontinued
258980-03 100 g

Acrylonitrile discontinued

Sign In for Pricing
View Details