Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MMP13 protein

This Human MMP13 protein spans the amino acid sequence from region 104-471aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MMP13

UniProt

P45452

Expression Region

104-471aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

58.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 104-471aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human TARS3 shRNA (UAS) - Lentiviral human TARS3 shRNA (UAS, GFP) (100)
GTR15083193 1 Vial

Lentiviral human TARS3 shRNA (UAS) - Lentiviral human TARS3 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Midecamycin Impurity 31
RM-M472031-01 10 mg

Midecamycin Impurity 31

Sign In for Pricing
View Details
Midecamycin Impurity 31
RM-M472031-02 25 mg

Midecamycin Impurity 31

Sign In for Pricing
View Details
Midecamycin Impurity 31
RM-M472031-03 50 mg

Midecamycin Impurity 31

Sign In for Pricing
View Details
Midecamycin Impurity 31
RM-M472031-04 100 mg

Midecamycin Impurity 31

Sign In for Pricing
View Details
SHH Rabbit pAb
MBS9143518-01 0.02 mL

SHH Rabbit pAb

Sign In for Pricing
View Details