Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MKI67 protein

This Human MKI67 protein spans the amino acid sequence from region 3120-3256aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MKI67

UniProt

P46013

Expression Region

3120-3256aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of His-SUMO-tag and expression region is 2891-3256aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NEKKPMKTSPEMDIQNPDDGARKPIPRDKVTENKRCLRSARQNESSQPKVAEESGGQKSAKVLMQNQKGKGEAGNSDSMCLRSRKTKSQPAASTLESKSVQRVTRSVKRCAENPKKAEDNVCVKKIRTRSHRDSEDI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Inosine pranobex
orb1303997-01 1 ml x 10 mM (in DMSO)

Inosine pranobex

Sign In for Pricing
View Details
Inosine pranobex
orb1303997-02 500 mg

Inosine pranobex

Sign In for Pricing
View Details
Inosine pranobex
orb1303997-03 1 g

Inosine pranobex

Sign In for Pricing
View Details
Inosine pranobex
orb1303997-04 5 g

Inosine pranobex

Sign In for Pricing
View Details
Human HSP90B1 Protein
orb81516-01 2 µg

Human HSP90B1 Protein

Sign In for Pricing
View Details
Human HSP90B1 Protein
orb81516-02 10 µg

Human HSP90B1 Protein

Sign In for Pricing
View Details