Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MAP2K6 protein

This Human MAP2K6 protein spans the amino acid sequence from region 1-334aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MAP2K6

UniProt

P52564

Expression Region

1-334aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

53.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-334aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit For Cytochrome c oxidase subunit 3
E10128r 96 Tests

ELISA Kit For Cytochrome c oxidase subunit 3

Sign In for Pricing
View Details
Phospho-PTEN (S294) Antibody [APR09201G]
APR09201G-01 50 µL

Phospho-PTEN (S294) Antibody [APR09201G]

Sign In for Pricing
View Details
Phospho-PTEN (S294) Antibody [APR09201G]
APR09201G-02 100 µL

Phospho-PTEN (S294) Antibody [APR09201G]

Sign In for Pricing
View Details
Phospho-PTEN (S294) Antibody [APR09201G]
APR09201G-03 200 µL

Phospho-PTEN (S294) Antibody [APR09201G]

Sign In for Pricing
View Details
Phospho-PTEN (S294) Antibody [APR09201G]
APR09201G-04 400 µL

Phospho-PTEN (S294) Antibody [APR09201G]

Sign In for Pricing
View Details
SERPING1 Antibody
MBS7129728-01 0.05 mL

SERPING1 Antibody

Sign In for Pricing
View Details