Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MAP2K3 protein

This Human MAP2K3 protein spans the amino acid sequence from region 1-347aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MAP2K3

UniProt

P46734

Expression Region

1-347aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

55.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-347aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Influenza A H7N7 Hemagglutinin Antibody (19) [Janelia Fluor 585]
NBP2-89790JF585 0.2 mL

Rabbit Monoclonal Influenza A H7N7 Hemagglutinin Antibody (19) [Janelia Fluor 585]

Sign In for Pricing
View Details
PDGFBB Rabbit Polyclonal Antibody (PE-Cy7)
orb912173 100 µL

PDGFBB Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
Rabbit Polyclonal SIX6 Antibody [Alexa Fluor 405]
NBP2-98116AF405 0.1 mL

Rabbit Polyclonal SIX6 Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
Methyl (methyl 3-deoxy-D-arabino-hept-2-ulopyranosid) onate
MM04932-01 2 mg

Methyl (methyl 3-deoxy-D-arabino-hept-2-ulopyranosid) onate

Sign In for Pricing
View Details
Methyl (methyl 3-deoxy-D-arabino-hept-2-ulopyranosid) onate
MM04932-02 5 mg

Methyl (methyl 3-deoxy-D-arabino-hept-2-ulopyranosid) onate

Sign In for Pricing
View Details
Methyl (methyl 3-deoxy-D-arabino-hept-2-ulopyranosid) onate
MM04932-03 10 mg

Methyl (methyl 3-deoxy-D-arabino-hept-2-ulopyranosid) onate

Sign In for Pricing
View Details