Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MAP2K3 protein

This Human MAP2K3 protein spans the amino acid sequence from region 1-347aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MAP2K3

UniProt

P46734

Expression Region

1-347aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

55.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-347aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLD1 Polyclonal Antibody
MBS9135067-01 0.02 mL

PLD1 Polyclonal Antibody

Sign In for Pricing
View Details
PLD1 Polyclonal Antibody
MBS9135067-02 0.1 mL

PLD1 Polyclonal Antibody

Sign In for Pricing
View Details
PLD1 Polyclonal Antibody
MBS9135067-03 5x 0.1 mL

PLD1 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Laminin Beta 2 Polyclonal Antibody
TMAB-08209-01 50 μL

Anti-Laminin Beta 2 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Laminin Beta 2 Polyclonal Antibody
TMAB-08209-02 100 µL

Anti-Laminin Beta 2 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Laminin Beta 2 Polyclonal Antibody
TMAB-08209-03 200 µL

Anti-Laminin Beta 2 Polyclonal Antibody

Sign In for Pricing
View Details