Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LSM4 protein

This Human LSM4 protein spans the amino acid sequence from region 1-139aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LSM4

UniProt

Q9Y4Z0

Expression Region

1-139aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-139aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVKEEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3- (3’-Chlorophenyl) -7-ethoxycoumarin
OR351185 1 Each

3- (3’-Chlorophenyl) -7-ethoxycoumarin

Sign In for Pricing
View Details
GBD2-set siRNA/shRNA/RNAi Lentivector (Human)
21348091 4x 500 ng

GBD2-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
AMPD3 sgRNA CRISPR Lentivector (Human) (Target 3)
K0082304 1.0 µg DNA

AMPD3 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
ICOS Ligand (ICOSLG) Mouse Monoclonal Antibody [Clone ID: OTI2G10]
TA808594S 30 µL

ICOS Ligand (ICOSLG) Mouse Monoclonal Antibody [Clone ID: OTI2G10]

Sign In for Pricing
View Details
Mouse Matrix metalloproteinase 2 antibody (MMP2-Ab) ELISA Kit
EK12189 48 Tests

Mouse Matrix metalloproteinase 2 antibody (MMP2-Ab) ELISA Kit

Sign In for Pricing
View Details
MAST3 Rabbit Polyclonal Antibody (AP)
orb955582 100 µL

MAST3 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details