Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LSM4 protein

This Human LSM4 protein spans the amino acid sequence from region 1-139aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LSM4

UniProt

Q9Y4Z0

Expression Region

1-139aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-139aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVKEEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF384 siRNA (h)
sc-96211 10 µM

ZNF384 siRNA (h)

Sign In for Pricing
View Details
mmu-miR-6337 miRNA Inhibitor
MIM02339 2x 5.0 nmol

mmu-miR-6337 miRNA Inhibitor

Sign In for Pricing
View Details
SEMA6B (Semaphorin-6B, Semaphorin-Z, Sema Z, SEMA6B, SEMAN, SEMAZ) (PE)
MBS6459186-01 0.2 mL

SEMA6B (Semaphorin-6B, Semaphorin-Z, Sema Z, SEMA6B, SEMAN, SEMAZ) (PE)

Sign In for Pricing
View Details
SEMA6B (Semaphorin-6B, Semaphorin-Z, Sema Z, SEMA6B, SEMAN, SEMAZ) (PE)
MBS6459186-02 5x 0.2 mL

SEMA6B (Semaphorin-6B, Semaphorin-Z, Sema Z, SEMA6B, SEMAN, SEMAZ) (PE)

Sign In for Pricing
View Details
Human Enamelin (ENAM) ELISA Kit
GTR10324538 96 Well

Human Enamelin (ENAM) ELISA Kit

Sign In for Pricing
View Details
[KO Validated] STAT3 Rabbit mAb
E45R13030N-50 50 µL

[KO Validated] STAT3 Rabbit mAb

Sign In for Pricing
View Details